Protein Info for MMP_RS07880 in Methanococcus maripaludis S2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF13238: AAA_18" amino acids 3 to 123 (121 residues), 82.2 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 86% identical to KAD6_METM7: Putative adenylate kinase (MmarC7_0782) from Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

KEGG orthology group: None (inferred from 86% identity to mmx:MmarC6_1136)

Predicted SEED Role

"AMP/CMP kinase AK6" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>MMP_RS07880 AAA family ATPase (Methanococcus maripaludis S2)
IIIAITGTPGVGKSTVSKLLFEKLQLKGNDIACINITEIVSKEGFYLEKDVEMDSFVVDF
DKLNDYIQSIKKEDLILDGHVSHYLNPDYIVVLRANPLLIKNRLESRKYLPKKVKENVEA
ELLDVCLIESIEKNDESKIFEIDCSEKSPEDIVNEILMFLDSKNPEYGNVSWLEDYFYLI
E