Protein Info for MMP_RS07850 in Methanococcus maripaludis S2
Annotation: prephenate dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to PHEA_METJA: Prephenate dehydratase (pheA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K01713, prephenate dehydratase [EC: 4.2.1.51] (inferred from 100% identity to mmp:MMP1528)Predicted SEED Role
"Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-phenylalanine biosynthesis (9/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- superpathway of chorismate metabolism (25/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.51
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LX25 at UniProt or InterPro
Protein Sequence (268 amino acids)
>MMP_RS07850 prephenate dehydratase (Methanococcus maripaludis S2) MICCLGPRGSYSEKAAVTFSKAINDSEIQFEDSIYNVFKAVETNPEFFGVVPSENSIGGS VSITQDLLLEFPVKILGEVDISINHCLLGYDIKKVTEVLAHPQALAQCGHYITKNNWNIT PVDSNAKAAKIVSEEKDEKLAAICGVENAEIYGLNVLDEYIQDFKNNTTRFFLICNKNKN FKTDLKPKKASIVVELNKNMPGAFYEVLGVFKYRNVNLTRIESRPSKKEIGNYVFYIDYE YYDDNSALLRDLRIWALNVIELGNYFVL