Protein Info for MMP_RS07830 in Methanococcus maripaludis S2

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details signal peptide" amino acids 26 to 26 (1 residues), see Phobius details PF02355: SecD_SecF_C" amino acids 95 to 274 (180 residues), 131.8 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 57% identical to SECF_METJA: Protein-export membrane protein SecF (secF) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 100% identity to mmp:MMP1524)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX29 at UniProt or InterPro

Protein Sequence (281 amino acids)

>MMP_RS07830 protein translocase subunit SecF (Methanococcus maripaludis S2)
MNINYKVLTIIPIILALLSLTLVSVNGLKESIDVSGGTEISILAPANTDLSVLKEQLPDS
EVKISESSIGTFVVIKSGLETDVDSVRAVVKEFFNVEDLSELSYTEKQIGSVLSSKFWEE
GMKAVGFAFIFMAIVVYAIFRTPVPSGAVILAAASDMAIAVGGMSLFNIPISTATIAALL
MLVGYSVDTDIMLTTRVLKRRSGTLDERIAGAMKTGITMSLTTIFAMAVLYLVVTFVVPA
ADVLANIAAVLLIGLIGDLMLTWMTNAGILKYYMSEYKKGK