Protein Info for MMP_RS07805 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 67 to 248 (182 residues), 67.7 bits, see alignment E=5.8e-23

Best Hits

Swiss-Prot: 58% identical to WTPB_METJA: Molybdate/tungstate transport system permease protein WtpB (wtpB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02060, putative sulfate transport system permease protein (inferred from 100% identity to mmp:MMP1519)

Predicted SEED Role

"Tungstate ABC transporter, permease protein WtpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX34 at UniProt or InterPro

Protein Sequence (255 amino acids)

>MMP_RS07805 ABC transporter permease (Methanococcus maripaludis S2)
LKADKGFNLLFLVISLFLLLFVLLPLLNMILNPGNVAGAFNDSEVIKSLLVSIKAAGTAT
VLAIFLGIPLSYLLARYHFTGKNVVEAIIDIPMAIPHSVIGIMILAFFYGTSIGRGIEDI
GFEIVDNFWGIVVVMLYVGLPYMVNSGRDGFLMVEEELENVSRTLGASKIKTFFNISLPL
IKNNLVSGSILTFARGISEVGAILIVAYFPKTTPVLILDRFNEYGLSSSKPISVIMIVLS
IILFSVFRLVRYNKK