Protein Info for MMP_RS07775 in Methanococcus maripaludis S2

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00518: alanine dehydrogenase" amino acids 1 to 371 (371 residues), 581.9 bits, see alignment E=2.5e-179 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 177 bits, see alignment E=5.7e-56 PF01262: AlaDh_PNT_C" amino acids 141 to 353 (213 residues), 304 bits, see alignment E=1.3e-94 PF02826: 2-Hacid_dh_C" amino acids 167 to 268 (102 residues), 27.8 bits, see alignment E=4e-10 PF07992: Pyr_redox_2" amino acids 167 to 222 (56 residues), 28.1 bits, see alignment 3.4e-10 PF00070: Pyr_redox" amino acids 171 to 222 (52 residues), 27.4 bits, see alignment 1e-09

Best Hits

Swiss-Prot: 100% identical to DHA_METMP: Alanine dehydrogenase (ald) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 100% identity to mmp:MMP1513)

MetaCyc: 66% identical to alanine dehydrogenase subunit (Klebsiella aerogenes)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX40 at UniProt or InterPro

Protein Sequence (373 amino acids)

>MMP_RS07775 alanine dehydrogenase (Methanococcus maripaludis S2)
MLIGVPKEIKNNENRVAITPAGVEAFVLAGHKVYIEKGAGLGSAITDEEYVAAGAEILAT
AKEVFDTAEMIIKVKEPLKSEFELFKEGQILFTYLHLAPEPQLTKALLDKKITGIAYETV
QLADRSLPLLTPMSEIAGRMSIQLGAQYLEKQEGGKGVLLGGVPGVEPAEVVIVGGGIVG
TNAAKIAVGMGAKVTILDVNTRRLAYLDDIFGNKVTTLMSNSFNIAKAVKKADLLVGCVL
IPGAKAPKLVSEEMVKSMQPGSVIVDVAIDQGGSIETIDRITTHDNPTYEKFGVIHYAVA
NIPGAVARTSTYALTNDTLPYALQIANKGYKQAVIENPALLKGLNTLNGKVTYEAVAKAH
DLPYTPAEKALNE