Protein Info for MMP_RS07755 in Methanococcus maripaludis S2

Annotation: DUF555 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF04475: DUF555" amino acids 4 to 112 (109 residues), 154 bits, see alignment E=7.4e-50

Best Hits

Swiss-Prot: 100% identical to Y1509_METMI: UPF0212 protein in gatA 3'region from Methanococcus maripaludis

KEGG orthology group: K09731, hypothetical protein (inferred from 100% identity to mmz:MmarC7_0753)

Predicted SEED Role

"Uncharacterized protein MJ0068"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW69 at UniProt or InterPro

Protein Sequence (113 amino acids)

>MMP_RS07755 DUF555 domain-containing protein (Methanococcus maripaludis S2)
MGNYHVTLQASYIAKNVEDVEDAIGVAISQIGKLLNKGSLDYVDIDVGLTICPKCGEPID
CVLVVAKTAIVGILLSMKVFNAESPEHAVRIAKSSIGRALKDIPLEDVDVVEI