Protein Info for MMP_RS07745 in Methanococcus maripaludis S2

Annotation: pyruvate ferredoxin oxidoreductase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR02175: 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family" amino acids 1 to 173 (173 residues), 236.7 bits, see alignment E=7e-75 PF01558: POR" amino acids 3 to 171 (169 residues), 149.7 bits, see alignment E=4.3e-48

Best Hits

Swiss-Prot: 77% identical to PORC_METJA: Pyruvate synthase subunit PorC (porC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00172, pyruvate ferredoxin oxidoreductase, gamma subunit [EC: 1.2.7.1] (inferred from 100% identity to mmp:MMP1507)

MetaCyc: 68% identical to pyruvate synthase subunit gamma (Methanothermobacter thermautotrophicus Delta H)
Pyruvate synthase. [EC: 1.2.7.1]

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, gamma subunit (EC 1.2.7.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX45 at UniProt or InterPro

Protein Sequence (176 amino acids)

>MMP_RS07745 pyruvate ferredoxin oxidoreductase subunit gamma (Methanococcus maripaludis S2)
MKEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRL
RSQIYEPNYVIVQDPTLMDSVDVTSGIKDGGIILINTLKDIKLNGYDVKTIDATGIALEV
LGVPIVNTTLCGAFAGLTGEVTIESLKKSILETFPGKLGPKNADAAEKAYNLTKGL