Protein Info for MMP_RS07670 in Methanococcus maripaludis S2

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00336: orotate phosphoribosyltransferase" amino acids 16 to 181 (166 residues), 176.4 bits, see alignment E=2.2e-56 PF00156: Pribosyltran" amino acids 46 to 164 (119 residues), 40.9 bits, see alignment E=6.9e-15

Best Hits

Swiss-Prot: 100% identical to PYRE_METMP: Orotate phosphoribosyltransferase (pyrE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to mmp:MMP1492)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.10

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX60 at UniProt or InterPro

Protein Sequence (185 amino acids)

>MMP_RS07670 orotate phosphoribosyltransferase (Methanococcus maripaludis S2)
LVTTEEISLKNELIRLLKDVNCVKFGDFTLASGKQSKYYVDIKKATTNPKVLKAAAKLVN
YYVSKENNENLKIAGVELGSVSIATAVSLETEKDLLIIRKKAKEYGTKNKIEGELNPGDN
VIVMEDVTTTGGSVSKAVDEIRAVSGNVKKIYVIVDRQEGAKENLAQNNVELIPLVTIEE
LGLNK