Protein Info for MMP_RS07625 in Methanococcus maripaludis S2

Annotation: cobalt ECF transporter T component CbiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 25 to 37 (13 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 112 to 139 (28 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details PF02361: CbiQ" amino acids 14 to 222 (209 residues), 168.9 bits, see alignment E=6.6e-54 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 19 to 218 (200 residues), 176.4 bits, see alignment E=3.2e-56

Best Hits

Swiss-Prot: 48% identical to Y1089_METJA: Uncharacterized protein MJ1089 (MJ1089) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to mmp:MMP1483)

Predicted SEED Role

"Transmembrane component CbiQ of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX69 at UniProt or InterPro

Protein Sequence (257 amino acids)

>MMP_RS07625 cobalt ECF transporter T component CbiQ (Methanococcus maripaludis S2)
MTNSTLIDNIANYNKLRSVNPTLKVIFAISSLFVSIFSKNFIVPLLITIIMSFVIIFAAK
IPKNIYGKLLAIPIFFGIITFLMMTFLFGTDIYTSFDFFGITINLLKDGFSLGLLTFFKM
LGGVSCTLFLALTTPFTELFYILKRSKMPKNMLEIAMMMYRYIFMLLEEALTMENSQKTR
LGYKNLKTSYHSLGLLTGSLFIKALDKGDIIYNSLNSRGYDGNLMFFGDIAYPRTFSIVL
LGAFELMLLSLNYITIF