Protein Info for MMP_RS07620 in Methanococcus maripaludis S2

Annotation: energy-coupling factor ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details TIGR01165: cobalt transport protein" amino acids 1 to 90 (90 residues), 129 bits, see alignment E=3.1e-42 PF02553: CbiN" amino acids 6 to 76 (71 residues), 104.1 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 100% identical to CBIN_METMP: Cobalt transport protein CbiN (cbiN) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02009, cobalt transport protein (inferred from 100% identity to mmp:MMP1482)

Predicted SEED Role

"Additional substrate-specific component CbiN of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX70 at UniProt or InterPro

Protein Sequence (98 amino acids)

>MMP_RS07620 energy-coupling factor ABC transporter substrate-binding protein (Methanococcus maripaludis S2)
MEFKHVLMILGVIILTLAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE
PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYDAKNQ