Protein Info for MMP_RS07615 in Methanococcus maripaludis S2

Annotation: energy-coupling factor ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 100 (27 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details TIGR00123: cobalamin biosynthesis protein CbiM" amino acids 1 to 210 (210 residues), 310.1 bits, see alignment E=4.4e-97 PF01891: CbiM" amino acids 2 to 208 (207 residues), 188.4 bits, see alignment E=7.6e-60

Best Hits

Swiss-Prot: 71% identical to CBIM_METV3: Putative cobalt transport protein CbiM (cbiM) from Methanococcus voltae (strain ATCC BAA-1334 / A3)

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to mmp:MMP1481)

Predicted SEED Role

"Substrate-specific component CbiM of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX71 at UniProt or InterPro

Protein Sequence (225 amino acids)

>MMP_RS07615 energy-coupling factor ABC transporter permease (Methanococcus maripaludis S2)
VHIMEGFLPPMWAAFWFVLSGIVVIYGIIQLNKLINNKPEVKPTLALAGAFMFILSSLKL
PSVTGSCSHPTGGGLGAIMFGPAITAVLATIVLLFQAILLAHGGLTTLGANIFSMGIMGP
AIGFLVFKLLKGKLNITWVVVLAAIFADWGTYATTSVQLALAYPLPDFGTALANFGTVFA
VTQIPLAIMEGLLTGLIWDYIMKLRPDLLAKLGLIDLEKAKGGAE