Protein Info for MMP_RS07550 in Methanococcus maripaludis S2

Annotation: L-serine ammonia-lyase iron-sulfur-dependent subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 236 to 250 (15 residues), see Phobius details amino acids 262 to 277 (16 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF03313: SDH_alpha" amino acids 197 to 377 (181 residues), 111.6 bits, see alignment E=2.8e-36

Best Hits

Swiss-Prot: 100% identical to CYDE_METMP: L-cysteine desulfidase (MMP1468) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1468)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX84 at UniProt or InterPro

Protein Sequence (396 amino acids)

>MMP_RS07550 L-serine ammonia-lyase  iron-sulfur-dependent  subunit alpha (Methanococcus maripaludis S2)
MDDYKRILITKILKNEVTEALGCTEVGLIGYAVSLCNISDPFSIEKIELTLNNGSFKNAY
AVGVPNTKKYGILPAVVGGLLGDHKNKLLVFNGIKYSQKLEDFIKERLKIRVINSPLYCG
VKIKDNSGNTFESLIKDNHLNVVIPKINNKLISEINGSEKEEYKNLELLDFLEYIDEIPE
EIIQLVEKTIYTNNNLIKGDFLNFGNDCLSNMVNKTTSACNTRMIGENMPAMSVAKSGNM
GIMATLPIIAYDYSNEQNQEKLIKSILLSVLVTIYATYKSSYLSSMCGCVSKGGMGAVIG
LCYYKNGKNIKKLDSAARTFTANLPGIICDGGKVGCALKLASGCFAAYSSLFVDISYENG
IVGKNFKECVENISEISKIMGDLDSDIVKIMSKKEI