Annotation: 4Fe-4S binding protein
These analyses and tools can help you predict a protein's function, but be skeptical.
For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect.
For other types of proteins, the error rates may be much higher.
MetaCyc and Swiss-Prot have low error rates,
but the best hits in these databases are often quite distant,
so this protein's function may not be the same.
TIGRFam has low error rates.
Finally, many experimentally-characterized proteins are not in any of these databases.
To find relevant papers, use PaperBLAST.
Protein Families and Features
1
50
100
150
200
252
PF00037: Fer4 "
amino acids 42 to 64 (23 residues), 31.2 bits, see alignment (E = 8.9e-11)
amino acids 73 to 94 (22 residues), 27.2 bits, see alignment (E = 1.7e-09)
amino acids 129 to 150 (22 residues), 32.2 bits, see alignment (E = 4.2e-11)
amino acids 158 to 180 (23 residues), 25.4 bits, see alignment (E = 5.9e-09)
amino acids 196 to 216 (21 residues), 27.2 bits, see alignment (E = 1.6e-09)
amino acids 225 to 245 (21 residues), 23.6 bits, see alignment (E = 2.2e-08)
PF13237: Fer4_10 "
amino acids 42 to 90 (49 residues), 34.3 bits, see alignment
1.2e-11
amino acids 129 to 175 (47 residues), 30.2 bits, see alignment
2.3e-10
amino acids 158 to 212 (55 residues), 28.7 bits, see alignment
E=6.4e-10
amino acids 194 to 241 (48 residues), 25.9 bits, see alignment
4.9e-09
PF14697: Fer4_21 "
amino acids 43 to 95 (53 residues), 38.5 bits, see alignment
E=6.9e-13
amino acids 129 to 180 (52 residues), 39.3 bits, see alignment
E=3.8e-13
PF12800: Fer4_4 "
amino acids 46 to 60 (15 residues), 11.8 bits, see alignment (E = 0.00018)
amino acids 76 to 92 (17 residues), 14.4 bits, see alignment (E = 2.6e-05)
amino acids 132 to 146 (15 residues), 16.6 bits, see alignment (E = 5.3e-06)
amino acids 162 to 176 (15 residues), 15.3 bits, see alignment (E = 1.4e-05)
amino acids 199 to 214 (16 residues), 16.1 bits, see alignment (E = 7.9e-06)
PF13187: Fer4_9 "
amino acids 47 to 94 (48 residues), 29.1 bits, see alignment
5.4e-10
amino acids 78 to 149 (72 residues), 27.9 bits, see alignment
E=1.2e-09
amino acids 134 to 179 (46 residues), 29.5 bits, see alignment
4e-10
amino acids 164 to 216 (53 residues), 31.7 bits, see alignment
E=8.2e-11
amino acids 201 to 245 (45 residues), 29 bits, see alignment
5.6e-10
PF12838: Fer4_7 "
amino acids 47 to 93 (47 residues), 35.1 bits, see alignment
9.7e-12
amino acids 133 to 178 (46 residues), 38.6 bits, see alignment
7.9e-13
amino acids 164 to 215 (52 residues), 36.8 bits, see alignment
E=2.9e-12
amino acids 200 to 244 (45 residues), 30.5 bits, see alignment
2.6e-10
PF12798: Fer4_3 "
amino acids 48 to 62 (15 residues), 16.8 bits, see alignment (E = 6.4e-06)
amino acids 134 to 148 (15 residues), 13.5 bits, see alignment (E = 7.2e-05)
amino acids 164 to 178 (15 residues), 15.4 bits, see alignment (E = 1.8e-05)
amino acids 201 to 215 (15 residues), 16.2 bits, see alignment (E = 9.8e-06)
amino acids 230 to 244 (15 residues), 15.2 bits, see alignment (E = 2.1e-05)
PF12837: Fer4_6 "
amino acids 73 to 94 (22 residues), 24.2 bits, see alignment (E = 1.5e-08)
PF13534: Fer4_17 "
amino acids 78 to 146 (69 residues), 28.2 bits, see alignment
E=1.5e-09
PF13484: Fer4_16 "
amino acids 78 to 146 (69 residues), 31.1 bits, see alignment
E=2.1e-10
Best Hits Swiss-Prot: 50% identical to Y514_METJA : Uncharacterized polyferredoxin-like protein MJ0514 (MJ0514) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: None (inferred from 100% identity to
mmp:MMP1465 )
Predicted SEED Role "Energy conserving hydrogenase Eha associated polyferredoxin"
Sequence Analysis Tools PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LX87 at UniProt or InterPro
Protein Sequence (252 amino acids) >MMP_RS07535 4Fe-4S binding protein (Methanococcus maripaludis S2)
MITVKKPVQKIISDISKNLGIDEKFVKEKLKDLIVPVERNLYVESNKCIRCELCYEMCPV
DAIKEPSVKSPAEILPEKCVKCEICAKTCPVGAINVLEGRAKLEEDNVVYELKEIDVTHR
KIRLVKHELDEESCIKCGICERFCPTSAITVEKRNSIDINLNLCMGCTACEKVCPKSAIK
VENEMGEITAENEISLNNDTCINCMVCSEICPVGAIVYEDGLMKLDDKMCIFCGKCEKNC
PVTAIAIKQKNM