Annotation: 4Fe-4S binding protein
These analyses and tools can help you predict a protein's function, but be skeptical.
For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect.
For other types of proteins, the error rates may be much higher.
MetaCyc and Swiss-Prot have low error rates,
but the best hits in these databases are often quite distant,
so this protein's function may not be the same.
TIGRFam has low error rates.
Finally, many experimentally-characterized proteins are not in any of these databases.
To find relevant papers, use PaperBLAST.
Protein Families and Features
1
50
100
150
200
250
300
350
393
PF13237: Fer4_10 "
amino acids 45 to 95 (51 residues), 33 bits, see alignment
3.5e-11
amino acids 152 to 232 (81 residues), 38 bits, see alignment
E=9.7e-13
amino acids 214 to 256 (43 residues), 28.4 bits, see alignment
9.8e-10
amino acids 277 to 326 (50 residues), 25.9 bits, see alignment
5.9e-09
PF00037: Fer4 "
amino acids 46 to 65 (20 residues), 25.8 bits, see alignment (E = 5.1e-09)
amino acids 77 to 99 (23 residues), 29.7 bits, see alignment (E = 3e-10)
amino acids 123 to 144 (22 residues), 33.9 bits, see alignment (E = 1.5e-11)
amino acids 215 to 232 (18 residues), 26.9 bits, see alignment (E = 2.3e-09)
amino acids 308 to 331 (24 residues), 33.7 bits, see alignment (E = 1.7e-11)
PF12800: Fer4_4 "
amino acids 46 to 60 (15 residues), 15.5 bits, see alignment (E = 1.4e-05)
amino acids 83 to 96 (14 residues), 15.6 bits, see alignment (E = 1.3e-05)
amino acids 126 to 140 (15 residues), 18.7 bits, see alignment (E = 1.3e-06)
amino acids 157 to 170 (14 residues), 13.3 bits, see alignment (E = 7.1e-05)
amino acids 218 to 232 (15 residues), 19.3 bits, see alignment (E = 8.2e-07)
amino acids 281 to 294 (14 residues), 12.5 bits, see alignment (E = 0.00013)
amino acids 312 to 327 (16 residues), 19.2 bits, see alignment (E = 9.1e-07)
PF12838: Fer4_7 "
amino acids 48 to 98 (51 residues), 42.7 bits, see alignment
4.7e-14
amino acids 83 to 142 (60 residues), 44.5 bits, see alignment
E=1.3e-14
amino acids 128 to 171 (44 residues), 30.2 bits, see alignment
3.7e-10
amino acids 158 to 232 (75 residues), 33.4 bits, see alignment
E=3.8e-11
amino acids 282 to 329 (48 residues), 34.1 bits, see alignment
2.3e-11
PF13187: Fer4_9 "
amino acids 48 to 98 (51 residues), 31.1 bits, see alignment
1.4e-10
amino acids 84 to 143 (60 residues), 34.6 bits, see alignment
E=1.2e-11
amino acids 128 to 172 (45 residues), 27.7 bits, see alignment
1.6e-09
amino acids 158 to 234 (77 residues), 33.3 bits, see alignment
E=3.1e-11
PF12798: Fer4_3 "
amino acids 49 to 63 (15 residues), 13.3 bits, see alignment (E = 0.0001)
amino acids 84 to 97 (14 residues), 15.2 bits, see alignment (E = 2.5e-05)
amino acids 128 to 142 (15 residues), 15.7 bits, see alignment (E = 1.7e-05)
amino acids 221 to 233 (13 residues), 16.4 bits, see alignment (E = 1e-05)
amino acids 315 to 329 (15 residues), 16.2 bits, see alignment (E = 1.1e-05)
PF12797: Fer4_2 "
amino acids 76 to 96 (21 residues), 24.8 bits, see alignment (E = 1.1e-08)
PF12837: Fer4_6 "
amino acids 76 to 99 (24 residues), 28.3 bits, see alignment (E = 9.1e-10)
amino acids 213 to 232 (20 residues), 24.9 bits, see alignment (E = 1.1e-08)
amino acids 308 to 330 (23 residues), 24.4 bits, see alignment (E = 1.5e-08)
PF14697: Fer4_21 "
amino acids 123 to 174 (52 residues), 38.8 bits, see alignment
6.2e-13
amino acids 278 to 331 (54 residues), 43.5 bits, see alignment
2.2e-14
PF13183: Fer4_8 "
amino acids 155 to 234 (80 residues), 33 bits, see alignment
E=5.6e-11
PF13484: Fer4_16 "
amino acids 158 to 232 (75 residues), 31.8 bits, see alignment
E=1.5e-10
Best Hits Swiss-Prot: 53% identical to Y51B_METJA : Uncharacterized polyferredoxin-like protein MJ0514.2 (MJ0514.2) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group:
K14107 , energy-converting hydrogenase A subunit P (inferred from 100% identity to
mmp:MMP1463 )
Predicted SEED Role "Energy conserving hydrogenase Eha polyferredoxin (protein P3)"
Sequence Analysis Tools PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LX89 at UniProt or InterPro
Protein Sequence (393 amino acids) >MMP_RS07525 4Fe-4S binding protein (Methanococcus maripaludis S2)
MSSSIWYLYEFVRKKWFMRFTNAKSEKESFIPPERFRKIPVIFDLPEKCISCSACKESCP
SDAISMEFNEEFKKEMPVFDAGSCINCGNCVESCPTNVLEMGTLRKEAKELLWNVPKIIN
LLIDEEVCVSCGTCENACPVDAISHNNTGLYEIDVNLCVSCKNCLKACPVENAIVTYSEP
ELSEKIEIAQNIKFDRERLGSEFKEKSDVIAEIPRIVPSLCIGCGNCVDVCPGSIDLERL
KVTSCIKSGKCLEVCPTTAIRIGVPEKITKRTAECYIVDEEKCIGCRICYRSCNVPEAIL
ISKETNLPYINPEYCVRCGLCQNACPVDAIDYLKTETSEDLYSKRKIRDEFESILHSDLE
EFTKNYVLLKEEVKNLGKQSISGENIGEKRKDD