Protein Info for MMP_RS07495 in Methanococcus maripaludis S2

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 52 to 68 (17 residues), see Phobius details amino acids 71 to 97 (27 residues), see Phobius details amino acids 122 to 148 (27 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 206 to 232 (27 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00146: NADHdh" amino acids 8 to 263 (256 residues), 97.1 bits, see alignment E=6.6e-32

Best Hits

Swiss-Prot: 67% identical to Y520_METJA: Putative NADH-ubiquinone oxidoreductase MJ0520 (MJ0520) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14101, energy-converting hydrogenase A subunit J (inferred from 100% identity to mmp:MMP1457)

Predicted SEED Role

"Energy conserving hydrogenase Eha transmembrane protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX95 at UniProt or InterPro

Protein Sequence (286 amino acids)

>MMP_RS07495 NADH-quinone oxidoreductase subunit H (Methanococcus maripaludis S2)
MFNGLMYALYAFLVGGILLGFHRKLMARVQCRPGPPIIQYLIHTFKFYFKELTFPISAGN
PLYVFVALMDVMVWMSALSIAVVFESSLLILIGLYILQKIVEHGCGLSSGSPYGKVGGVR
SVFSAAAEIPLFAAAGIVYTVTHSLIIGDIINYQAVNGPLIFQLPICAFAVFVLVLSKAP
FSPFAIVKGKDIISGYLTEHYGPLEAIIMIGDAIAWFVLLWLFMALFLGPLIVASPVLTL
LGMFVLTIIISFICALTPLLAPNHSVMLQITIASLTLIDLAYRIIH