Protein Info for MMP_RS07480 in Methanococcus maripaludis S2

Annotation: EhaG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 125 to 155 (31 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details PF09878: DUF2105" amino acids 5 to 226 (222 residues), 278.8 bits, see alignment E=1.3e-87

Best Hits

Swiss-Prot: 60% identical to Y523_METJA: Uncharacterized protein MJ0523 (MJ0523) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14098, energy-converting hydrogenase A subunit G (inferred from 100% identity to mmp:MMP1454)

Predicted SEED Role

"Energy conserving hydrogenase Eha transmembrane protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX98 at UniProt or InterPro

Protein Sequence (228 amino acids)

>MMP_RS07480 EhaG family protein (Methanococcus maripaludis S2)
MDYVSLLFSKTVAVGFIVGIISLYSISRQKSDLNMILLTDLIEYGMLVIIAAIGSDLAEA
LILPGLVVGMAELLAVAEIFVSRNDLRKEGKPKKSKLLEEFMIKETPKMDINFSKMEVLY
TTPKFLAVILVIYGAILSGFTGGAVMASGLLFYVLSKRVLGKKILPEELKVSWEGISAFS
GIAWAIWILGFIGFFLFPSKWPYFLIIAGFGLAIKVGSKLGLIGELFE