Protein Info for MMP_RS07455 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details PF26645: EhaB" amino acids 7 to 160 (154 residues), 244.8 bits, see alignment E=1.5e-77

Best Hits

Swiss-Prot: 70% identical to Y527_METJA: Uncharacterized protein MJ0527 (MJ0527) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14093, energy-converting hydrogenase A subunit B (inferred from 100% identity to mmp:MMP1449)

Predicted SEED Role

"Energy conserving hydrogenase Eha transmembrane protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXA3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>MMP_RS07455 hypothetical protein (Methanococcus maripaludis S2)
MILIETGKILAAFAICWLNFVIVDTYFGLPKKPGVLGAKVIGKKIENVGGNINGGYFMGN
IVCSPDASAGTLMASIFYYLMGFEGGLIAALFIYIGNRLCNDTGYAGTIGTITATILIYL
FSGFISAEYFIAGMVLAIFSIQGVHHSAASRLLGSIARKMGRI