Protein Info for MMP_RS07425 in Methanococcus maripaludis S2

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR00231: small GTP-binding protein domain" amino acids 62 to 204 (143 residues), 74.2 bits, see alignment E=5.3e-25 PF02421: FeoB_N" amino acids 64 to 154 (91 residues), 47 bits, see alignment E=4e-16 PF01926: MMR_HSR1" amino acids 64 to 172 (109 residues), 82.3 bits, see alignment E=5.8e-27 PF16897: MMR_HSR1_Xtn" amino acids 183 to 290 (108 residues), 116.4 bits, see alignment E=1.2e-37 PF02824: TGS" amino acids 292 to 364 (73 residues), 68.5 bits, see alignment E=8.2e-23

Best Hits

Swiss-Prot: 66% identical to Y1326_METJA: Uncharacterized GTP-binding protein MJ1326 (MJ1326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06944, (no description) (inferred from 100% identity to mmp:MMP1443)

Predicted SEED Role

"GTP-binding protein RBG1/RBG2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXA9 at UniProt or InterPro

Protein Sequence (369 amino acids)

>MMP_RS07425 GTP-binding protein (Methanococcus maripaludis S2)
MGIQEDIKKLEDELLHTQYNKATQKHVGILKAKLAKLRDEQQNPKGSGGSSGPSYAIRKT
GDATVAFVGFPSVGKSTLLNKLTNANSEVGAYAFTTLTIIPGLMEHKGAKIQVLDAPGII
SGASFGRGRGSEVLAAVRNVDLVMLVVDVFSPEHIPILEKELGNVGIRLDQEKPDVKIEK
HDRGGLAINKTVNLTKIDEGTITAIVGEHRIHNAAILIREDIDADQLIDVVLDSRSYIPT
LVIVNKIDLADEENLKKTEAAIGDRPHVFVSGHKEINLEELKDKIFETLGFIKLYLKPQG
GKADLEEPLIILKNSTVEDVCNRLHRDFVKNFRYALVWGESAKHPGQRVGLDHVLKDGDI
LTIVVRRSL