Protein Info for MMP_RS07415 in Methanococcus maripaludis S2

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein MobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF03205: MobB" amino acids 4 to 116 (113 residues), 70.9 bits, see alignment E=1.1e-23 PF04060: FeS" amino acids 151 to 178 (28 residues), 30.3 bits, see alignment (E = 2.8e-11)

Best Hits

Swiss-Prot: 45% identical to MOBB_METJA: Putative molybdopterin-guanine dinucleotide biosynthesis adapter protein (mobB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 100% identity to mmp:MMP1441)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB / FeS domain" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXB1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>MMP_RS07415 molybdopterin-guanine dinucleotide biosynthesis protein MobB (Methanococcus maripaludis S2)
MIRVIGVIGRKDTGKTGLIANILKNLTGMSVATVKNSHMDLDVDSPDTDSYKLKQLADTS
IFVTNKGSAFYYDRMHLKDILAKLDCDLVIVEGFKEDLIELNIPKILVTEGGRGAELKDN
QTIMVIDDFKYDIDEVTAQVLEKAIVPSYNLNCGHCGYNCKGFANLLASGEVKWNKCVMS
TALTLIVDGKTIPVNPFVSDIIKNTIKGIVGTLKGTENPETISIKIEKK