Protein Info for MMP_RS07395 in Methanococcus maripaludis S2

Annotation: DNA topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF04406: TP6A_N" amino acids 71 to 133 (63 residues), 50.2 bits, see alignment E=2.7e-17 PF20768: Topo_VI_alpha" amino acids 137 to 186 (50 residues), 72.7 bits, see alignment 2.6e-24 PF21180: TOP6A-Spo11_Toprim" amino acids 188 to 357 (170 residues), 214.8 bits, see alignment E=1.2e-67

Best Hits

Swiss-Prot: 76% identical to TOP6A_METJA: Type 2 DNA topoisomerase 6 subunit A (top6A) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03166, DNA topoisomerase VI subunit A [EC: 5.99.1.3] (inferred from 100% identity to mmp:MMP1437)

Predicted SEED Role

"DNA topoisomerase VI subunit A (EC 5.99.1.3)" in subsystem DNA topoisomerases, Type II, ATP-dependent (EC 5.99.1.3)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.3

Use Curated BLAST to search for 5.99.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXB5 at UniProt or InterPro

Protein Sequence (365 amino acids)

>MMP_RS07395 DNA topoisomerase IV subunit A (Methanococcus maripaludis S2)
VITSEERNLAAKKLLKLANGMYEDIIRGKRPKLTFPIRSLANAKFDVEKGTFAILGKEKD
RMLTVNQAKIFAQTIKMMEFSKGLLDTNDFSTLREAYYVSKNWGEARFDDQQPSNGVIED
IEAASEFLREDLGFIPEEDGAAVIGPLRIVDRTAEGDEIKIDCTKLGSGAYSIPNDVTKL
EFETKADFILAIETAGMFARLNAEGFWKKHNCILISLKGVPARATRRFIKRLNEEYKLPI
LVFTDGDPYGYLNIYRTLKVGSGKAVHLADKLAVPEARLIGVTPQDIVDYELPTHPLKDH
DIKRLKDGLKNDDFVKSFPQWQNALVQMADSKVRAEQQSLAKYGLKYVVEEYLPAKVEDS
STWLP