Protein Info for MMP_RS07345 in Methanococcus maripaludis S2

Updated annotation (from data): glycine synthesis protein GlyXL
Rationale: Important in minimal medium except when glycine is added. A homolog from Bifidobacterium has similar phenotypes, so this appears to be part of a novel route for glycine synthesis, along with GlyXS (MMP_RS03450).
Original annotation: PFL family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF05167: DUF711" amino acids 12 to 428 (417 residues), 618.5 bits, see alignment E=2.6e-190

Best Hits

Swiss-Prot: 100% identical to Y1427_METMP: UPF0210 protein MMP1427 (MMP1427) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09157, hypothetical protein (inferred from 100% identity to mmp:MMP1427)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXC5 at UniProt or InterPro

Protein Sequence (458 amino acids)

>MMP_RS07345 glycine synthesis protein GlyXL (Methanococcus maripaludis S2)
MFVPEEIIETIKMIEYQNLDIRTTTLGINLKDCADKDLDLLKENIYDKITSLGGNLVETA
NKVSQKYGIPIVNKRISVTPIGLIMGSTVKGLSDEEAVDACVEVGITLDKIAKEVGVDFI
GGYSALVQKRATYEEKMLIRSIPKLMTKTDKVCASVNVATTKAGINMYAVKKMGEIVKET
SEITKDAIGCAKIVVFCNAPEDNPFMAGAFHGPGEGDAVINAGVSGPGVVRAVVEQLKGK
DIGTVSDEIKKTAFKITRMGELVGKEVANELGVNFGIVDLSLAPTPAIGDSIANILEAVG
LERCGTHGTTAALAMLNDAVKKGGAMASSNVGGLSGAFIPVSEDAGMIEAVEVGALRLEK
LEAMTCVCSVGLDMIAVPGKTPASTLSAIMADEMAIGMINKKTTAVRIIPVPGKDVGDYV
EYGGLLGTAPIMPVSEFSSEELIERGGRIPAPIQSLTN