Protein Info for MMP_RS07125 in Methanococcus maripaludis S2
Annotation: coenzyme F420-reducing hydrogenase FrhD protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to FRHD_METJA: Coenzyme F420 hydrogenase subunit delta (frhD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00442, coenzyme F420 hydrogenase delta subunit (inferred from 100% identity to mmp:MMP1383)Predicted SEED Role
"Coenzyme F420 hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Coenzyme F420 hydrogenase or Hydrogenases (EC 3.4.24.-)
Isozymes
Compare fitness of predicted isozymes for: 3.4.24.-
Use Curated BLAST to search for 3.4.24.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LXG8 at UniProt or InterPro
Protein Sequence (174 amino acids)
>MMP_RS07125 coenzyme F420-reducing hydrogenase FrhD protein (Methanococcus maripaludis S2) MEYSLTPSYLLKENMVLACGNILFADDGFSVHVIEKLQEILTEEEKENIALVDAGAGAPQ QVLTLIDSESKTKKIIVVDIIDYGLEPGEIKILTMDDLPKPDHTKVDSHDWPLSTTMYRV VRDSPREIDFKVVGCQKKYVSEPDVVLELSEEVQNAVDVAVDIVLSELRGKPIN