Protein Info for MMP_RS07095 in Methanococcus maripaludis S2

Annotation: PspC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details PF04024: PspC" amino acids 2 to 58 (57 residues), 84.4 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 100% identity to mmp:MMP1376)

Predicted SEED Role

"PspC domain protein, truncated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXH5 at UniProt or InterPro

Protein Sequence (80 amino acids)

>MMP_RS07095 PspC domain-containing protein (Methanococcus maripaludis S2)
MKRLYRSDKEKMLSGVCGGLAIYFNVDPTLIRLLWVLLFFMNPLMIIVYIIAAIIIPIAP
EGVLYDFSKEPEKIKAESGE