Protein Info for MMP_RS07040 in Methanococcus maripaludis S2
Annotation: 50S ribosomal protein L30e
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to RL30E_METM7: 50S ribosomal protein L30e (rpl30e) from Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
KEGG orthology group: K02908, large subunit ribosomal protein L30e (inferred from 97% identity to mmq:MmarC5_0213)Predicted SEED Role
"LSU ribosomal protein L30e" in subsystem Ribosome LSU eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LXI6 at UniProt or InterPro
Protein Sequence (106 amino acids)
>MMP_RS07040 50S ribosomal protein L30e (Methanococcus maripaludis S2) MRRRSNMDINRAIRVAVDTGNVVLGTKQAIKNIKHGEGQLVIVADNCAKDVREDIFYYTQ LSETPVYTHQATSIELGAICGKPFPVSALLVLEPGNSAILNVNNEE