Protein Info for MMP_RS07010 in Methanococcus maripaludis S2

Annotation: homocysteine biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 PF01837: HcyBio" amino acids 16 to 368 (353 residues), 471.4 bits, see alignment E=1.6e-145 PF00571: CBS" amino acids 390 to 445 (56 residues), 52.1 bits, see alignment 7e-18 amino acids 451 to 505 (55 residues), 59.7 bits, see alignment 2.9e-20

Best Hits

Swiss-Prot: 66% identical to Y100_METJA: Uncharacterized protein MJ0100 (MJ0100) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1359)

MetaCyc: 52% identical to L-aspartate semialdehyde sulfurtransferase (Methanosarcina acetivorans)
RXN-19380 [EC: 2.8.1.16]

Predicted SEED Role

"Uncharacterized ferredoxin oxidoreductase MJ0100"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXJ1 at UniProt or InterPro

Protein Sequence (513 amino acids)

>MMP_RS07010 homocysteine biosynthesis protein (Methanococcus maripaludis S2)
LKTVHEINEKIRNGDAVVVTAEEMIDIVDELGAEKAAVEIDVVTTGTFGAMCSSGAFLNF
GHSDPPIKMCKTYLNGVEAYSGIAAVDAYLGATQTNSDDDIDISYGGSHVLEDLVAGKEI
ELVAEGYTTDCYPRKKVETTITIDDLNQAILVNPRNCYQSYNGATNSTEEKIYTYMGALL
PEFGNLNYSGAGQLNPLQNDFNKETKTYNTLGMGTRIFLGGAQGYIAGSGTQHSPNGGFG
TLMVQGDLKEMSTKYLRGATIPKYGSTLYMGIGIPIPVLNAEIAKTCAIKDEDIAIPILD
YGIPRRDKPELGVTNYKDARSGKVTIEVEIEGKKVDKCMRSASVSSYKVSREISKELKNW
ISNSEFMLTQRLEPLKSAAPKPMKAKMKLVKDILSRPVVVGSLNTSITQASRVLIENNIN
HLPIVDENGKLSGIITSWDIAKAMAQDKHSISEIMTTYIVSATPDETIDMAARKMSRNNI
SGLPVVDSNNKVLGVVSAEDISKLIGRNGLHKI