Protein Info for MMP_RS06890 in Methanococcus maripaludis S2

Annotation: mevalonate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00549: mevalonate kinase
  • amino acids 7 to 290 (284 residues), 206.2 bits, E=3.5e-65
• PF00288: GHMP_kinases_N
  • amino acids 77 to 168 (92 residues), 63 bits, E=2.6e-21
• PF08544: GHMP_kinases_C
  • amino acids 236 to 304 (69 residues), 38 bits, E=1.7e-13

Best Hits

Swiss-Prot: 49% identical to MVK_METJA: Mevalonate kinase (mvk) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00869, mevalonate kinase [EC: 2.7.1.36] (inferred from 100% identity to mmp:MMP1335)

MetaCyc: 49% identical to mevalonate kinase monomer (Methanocaldococcus jannaschii)
Mevalonate kinase. [EC: 2.7.1.36]

Predicted SEED Role

"Mevalonate kinase (EC 2.7.1.36)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 2.7.1.36)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (8/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (5/7 steps found)
• mevalonate pathway II (haloarchaea) (5/7 steps found)
• isoprene biosynthesis II (engineered) (5/8 steps found)
• mevalonate pathway IV (archaea) (5/8 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
• superpathway of ergosterol biosynthesis I (7/26 steps found)
• superpathway of cholesterol biosynthesis (7/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.36

Sequence Analysis Tools

See Q6LXL5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>MMP_RS06890 mevalonate kinase (Methanococcus maripaludis S2)
MNTIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENFDTISIDLVDLNEIFEITPE
LIKNLEISNFSPALKYVICAVKSVIFYLSEFKNLKEIKPFKLKLYSEIPLSCGLGSSASV
VVTVIRSISNFYGIELDNDETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGKYKPM
PKDLEEFIKTCKFLVVNVEERTRKTAELVHDVSKHPEKEQIFEEIGKIIQNVRQVTDKAE
LGKLMNENHELLKKFGISTEKLDLVAKAGQKYAYGGKLTGAGGGGSAIILLKEDREELLK
ELKKIGVIGIYECKMAN