Protein Info for MMP_RS06885 in Methanococcus maripaludis S2

Annotation: 50S ribosome-binding GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF03193: RsgA_GTPase" amino acids 24 to 179 (156 residues), 37 bits, see alignment E=8e-13 PF00009: GTP_EFTU" amino acids 28 to 116 (89 residues), 30.9 bits, see alignment E=5e-11 PF01926: MMR_HSR1" amino acids 124 to 201 (78 residues), 59.6 bits, see alignment E=7.7e-20 PF02421: FeoB_N" amino acids 125 to 201 (77 residues), 37.6 bits, see alignment E=4.1e-13

Best Hits

Swiss-Prot: 58% identical to Y1464_METJA: Uncharacterized GTP-binding protein MJ1464 (MJ1464) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06948, (no description) (inferred from 100% identity to mmp:MMP1334)

Predicted SEED Role

"50S ribosomal subunit maturation GTPase RbgA (B. subtilis YlqF)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXL6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>MMP_RS06885 50S ribosome-binding GTPase (Methanococcus maripaludis S2)
MLNNSVKHLKMDNMENKIPMRRMVHKIIYECNIVLLVVDARDPETTRNRALEEYTIEKNK
KLIYVINKSDLVPKKILEKWKNKFKSENPDSSVVFVSAKEKLGTKMLRDEIKTYLNSNNI
KYGQVGIVGYPNVGKSSIINALTGKKSARSGLTAGLTVGEQWVKLTKDIKLLDSPGIIEP
KDEDELVISGALRYEKADDIISPALKILNRIHTFDNTILKEYYGFEIGEEINIELLEKIG
TKLNFLTKDGKIDIDRTSKSIIREFQNGKLNYHRMNLKKYEQKRTKNIDFITKHLKDFPF
INDADQIILHLENINELGKLNTRPVIGIKELDDAFVIISFSEKSRDTGRKKVEELARTSD
IELYSLGDGRVGKHRIYVGVGEKR