Protein Info for MMP_RS06870 in Methanococcus maripaludis S2

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details PF09335: VTT_dom" amino acids 32 to 146 (115 residues), 62.6 bits, see alignment E=2.7e-21

Best Hits

Swiss-Prot: 56% identical to Y201_METJA: Uncharacterized protein MJ0201 (MJ0201) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1331)

Predicted SEED Role

"Uncharacterized protein MJ0201"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXL9 at UniProt or InterPro

Protein Sequence (157 amino acids)

>MMP_RS06870 DedA family protein (Methanococcus maripaludis S2)
MDFVAVGMDLVSTYGLLAIFLIGFSEPIFQPIPTEVFMVGGLALGLDWRYVILVSTLGST
LGGIVTYFIASKYGEALFLKIFNREKYSSAEEFLTKWGPLGIIVISFTPIPFEVICWLSG
IFKMPFKIYVSALIISRIIKHGLVVLPFAALGSIFPF