Protein Info for MMP_RS06820 in Methanococcus maripaludis S2

Annotation: DNA-directed RNA polymerase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01193: RNA_pol_L
  • amino acids 9 to 163 (155 residues), 51.9 bits, E=5e-18
• PF01000: RNA_pol_A_bac
  • amino acids 61 to 121 (61 residues), 47.5 bits, E=2.1e-16

Best Hits

Swiss-Prot: 70% identical to RPOD_METJA: DNA-directed RNA polymerase subunit D (rpoD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03047, DNA-directed RNA polymerase subunit D [EC: 2.7.7.6] (inferred from 100% identity to mmp:MMP1322)

Predicted SEED Role

"DNA-directed RNA polymerase subunit D (EC 2.7.7.6)" in subsystem RNA polymerase archaeal (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

See Q6LXM8 at UniProt or InterPro

Protein Sequence (180 amino acids)

>MMP_RS06820 DNA-directed RNA polymerase subunit D (Methanococcus maripaludis S2)
MKMELKAPLSFSSALRRIMISEVPTYAIENVYFYENTSSMYDEVLAHRLGLIPIKGVPVS
GDEVIVLTISKEGPCTVYSSDLKSESGEPAFENIPIVKLAEDQKLELETEALVGTGKIHA
KWQPCNASYKQISNDEVEFKIESFGNMDAEDIIRSSLEILKNKAEKFLLELEGQELSDEN