Protein Info for MMP_RS06805 in Methanococcus maripaludis S2

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR03629: ribosomal protein uS13" amino acids 5 to 149 (145 residues), 191 bits, see alignment E=6.3e-61 PF00416: Ribosomal_S13" amino acids 11 to 138 (128 residues), 122.7 bits, see alignment E=6.6e-40

Best Hits

Swiss-Prot: 99% identical to RS13_METMP: 30S ribosomal protein S13 (rps13) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 97% identity to mmz:MmarC7_0564)

Predicted SEED Role

"SSU ribosomal protein S18e (S13p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXN1 at UniProt or InterPro

Protein Sequence (149 amino acids)

>MMP_RS06805 30S ribosomal protein S13 (Methanococcus maripaludis S2)
VTQTEFKHRIRISKTDLEGKNPLEYALQDMKGIGRAMARAVIRVTELDPKQQAGYLADED
VLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTVQEDITNMKKIRCYKGI
RHELRLPCRGQRTRGSFRKGTSMGVKRKK