Protein Info for MMP_RS06750 in Methanococcus maripaludis S2

Annotation: IMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR01922: IMP cyclohydrolase" amino acids 1 to 200 (200 residues), 269 bits, see alignment E=1.2e-84 PF07826: IMP_cyclohyd" amino acids 2 to 194 (193 residues), 264.9 bits, see alignment E=1.9e-83

Best Hits

Swiss-Prot: 100% identical to PURO_METMP: IMP cyclohydrolase (purO) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K11176, IMP cyclohydrolase [EC: 3.5.4.10] (inferred from 100% identity to mmp:MMP1310)

MetaCyc: 63% identical to inosine monophosphate cyclohydrolase (Methanocaldococcus jannaschii)
IMP cyclohydrolase. [EC: 3.5.4.10]

Predicted SEED Role

"IMP cyclohydrolase (EC 3.5.4.10) [alternate form]" in subsystem De Novo Purine Biosynthesis (EC 3.5.4.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXN9 at UniProt or InterPro

Protein Sequence (201 amino acids)

>MMP_RS06750 IMP cyclohydrolase (Methanococcus maripaludis S2)
MYIGRFLVLGKTDEGNPFVTYRVSSRSFPNRVAKVMNDETVAILPKDLEEMFKNPYITYN
CVKLVGDVAVATNGSHTDIIADKIKLGLPIRDALSYSLLTMDYEKDDYNTPRIAVVITKD
EAYMGYVTDSDVRIKKVELEAGKAYYLSVYEACKITEHQVISVTGKTAEEVTKFVMDYEE
FEKPVTAATVLVKDGFKLATI