Protein Info for MMP_RS06715 in Methanococcus maripaludis S2

Annotation: cache domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details PF14827: dCache_3" amino acids 43 to 303 (261 residues), 29 bits, see alignment E=2.8e-10 PF17201: Cache_3-Cache_2" amino acids 209 to 313 (105 residues), 100.7 bits, see alignment E=3.5e-32 PF17202: sCache_3_3" amino acids 211 to 311 (101 residues), 123.8 bits, see alignment E=1.4e-39 PF00672: HAMP" amino acids 336 to 385 (50 residues), 44.2 bits, see alignment 6.7e-15 PF00512: HisKA" amino acids 413 to 480 (68 residues), 69.7 bits, see alignment E=6.3e-23 PF02518: HATPase_c" amino acids 525 to 634 (110 residues), 111.2 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1303)

Predicted SEED Role

"Sensory transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXP6 at UniProt or InterPro

Protein Sequence (639 amino acids)

>MMP_RS06715 cache domain-containing protein (Methanococcus maripaludis S2)
MNTIPPIKRLGTKLIIYSIITALIPIVMLGAVSTDTINTEMTKQAQEKINDDLNTAESVV
NLKLDKISSLNKYIISNDNTITSLKNNNTAELKTLAISYKNTSAPDFVVFFDGQGNVVAR
SNSDVTGDNSYEDLFKKVVNSTGYTSIEVLDKDSIKYENVGELVNIDIKGTEDSINYSDS
VQDSAMALVSIEPIYDKNGKLLGAAMAADILNKDYSIVDTVKDASKDATTIFLDGVRVST
NVQDNGGRAIGTLVSEEVYNHVVLDGKTYYGRAFVVNEWYLTAYEPIYDSDNKIIGMLFV
GTPESKFLALQADVRNQTFVVGLIGLLIALIVSYLINRGIIKPLEQLKQGAEWVSNGRYD
QKVIVDSDDEFGELAKAFNKMATQINISDDKLKKHAEELKISYNELKELDKLKSELIAVV
SHELRTPLTSIKGYVELVLDGTMGAINDSQKKCLQVADDNIVRLRRLIESMLDLSKIERG
ELEMYREKVNLRSIVCDVIEYLKPLATEKNIKLNKEVEDIAIEADKDRITQVLTNLIENA
IKFSPANESILVSGVLEDEHIHLKVTDRGAGIPKKDMEKIFNRFYQVDSSTKRKKGGSGL
GLAVCKSIVEAHKGSIWVESELGKGSTFHIILPISAKDQ