Protein Info for MMP_RS06705 in Methanococcus maripaludis S2

Annotation: formate/nitrite transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 65 to 94 (30 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 9 to 267 (259 residues), 254.6 bits, see alignment E=4.2e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1301)

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXP8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>MMP_RS06705 formate/nitrite transporter family protein (Methanococcus maripaludis S2)
MDVNPPDKMVELAGNAGQVKGNLSPSQLLVRGVMGGAYIAMGGGLATVVGTGIGAAMGAG
LGKFMAAAVFPVGLILIILTGMELVTGDMMLLPVAVFQRKASYAQLIKVWIYVYIGNLIG
SLIYASMMAFGPLRSFDSATGEAAVNAFGQSAINTAQAKVLPYMAAGSMGWLAALVKGIG
CNWLVNLAVIGSMASTSILGKFFMIWFPIMAFVATGFEHCVANMYFIPTGMMLGATVSVA
DWWLWNIIPVTIGNIIGAVVFVAMIYQFAYGKKI