Protein Info for MMP_RS06670 in Methanococcus maripaludis S2

Annotation: glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00342: PGI" amino acids 70 to 419 (350 residues), 125.3 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 100% identical to G6PI_METMP: Probable glucose-6-phosphate isomerase (pgi) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01810, glucose-6-phosphate isomerase [EC: 5.3.1.9] (inferred from 100% identity to mmp:MMP1295)

Predicted SEED Role

"Glucose-6-phosphate isomerase (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXQ4 at UniProt or InterPro

Protein Sequence (438 amino acids)

>MMP_RS06670 glucose-6-phosphate isomerase (Methanococcus maripaludis S2)
MNGELSFKYDNVMEENLGNLGISNGKLESFNNESSKIIEILKEKELNGEFGFLDVLNDNL
DKYYELNEYSKNFENILIIGIGGSNLGLRAAETGILGSFTSRYEIPRIYYMDNSDPEKTH
DILSNIDLEKTLVFVISKSGNTVETLANFFIVRNLMKKKNIDLEKHVVSITSGGELEKIT
KKENYIHFEVPENVGGRFSVLSSVGIAPLSCTSVDIKKLIDGAKSIEKSCKCEDIFKNPA
LMNAVIHKLMYNRGKTVSVMMPYIERLRSFGMWYGQLWAESLGKNGFGQTPVIAVGATSQ
HSQLQLYMDGPNDKIATFLKVNKYRNDLKIEYEYDHHLSGHNLSEVITSELVGTENSMKH
NNIPNVKITLSKLNEITMGKLFLMYEMQTAISGELYGINAFDQPAVEYGKKIAHECLTGS
KVDSENKYINGKYIITSK