Protein Info for MMP_RS06590 in Methanococcus maripaludis S2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF13673: Acetyltransf_10" amino acids 44 to 139 (96 residues), 44.1 bits, see alignment E=3.9e-15 PF00583: Acetyltransf_1" amino acids 50 to 139 (90 residues), 62.3 bits, see alignment E=1.1e-20 PF13508: Acetyltransf_7" amino acids 57 to 139 (83 residues), 49.9 bits, see alignment E=7e-17 PF08445: FR47" amino acids 82 to 141 (60 residues), 24.7 bits, see alignment E=3.8e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP1281)

Predicted SEED Role

"Diamine acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXR8 at UniProt or InterPro

Protein Sequence (168 amino acids)

>MMP_RS06590 GNAT family N-acetyltransferase (Methanococcus maripaludis S2)
VNTNLKINIRPTTVSDVPLIFKFIKELAKYENLENHVTATEEIIKESLFGKKQYAEALIV
EADSEAVGLVLFFHNFSTFLGKPGIYIEDLYIKEEFRGKGIGRKIFEYLSNLAKERNCGK
IEWTVLEWNPARKFYEKMGGIPVEDWLIYRLTGDKLNELSENYQKSKN