Protein Info for MMP_RS06545 in Methanococcus maripaludis S2

Annotation: ferredoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 10 to 64 (55 residues), 25.7 bits, E=2.7e-09
• PF12838: Fer4_7
  • amino acids 17 to 64 (48 residues), 35.2 bits, E=4.3e-12

Best Hits

Swiss-Prot: 74% identical to VORC_METTH: Ketoisovalerate oxidoreductase subunit VorC (vorC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00188, 2-oxoisovalerate ferredoxin oxidoreductase, delta subunit [EC: 1.2.7.7] (inferred from 100% identity to mmp:MMP1273)

Predicted SEED Role

"Ketoisovalerate oxidoreductase subunit VorC (EC 1.2.7.7)" in subsystem Ketoisovalerate oxidoreductase (EC 1.2.7.7)

MetaCyc Pathways

• L-isoleucine biosynthesis V (3/3 steps found)
• L-isoleucine biosynthesis IV (5/6 steps found)
• L-isoleucine degradation III (oxidative Stickland reaction) (2/3 steps found)
• L-leucine degradation V (oxidative Stickland reaction) (2/3 steps found)
• L-valine degradation III (oxidative Stickland reaction) (2/3 steps found)
• 2-oxobutanoate degradation II (1/2 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.7

Use Curated BLAST to search for 1.2.7.7

Sequence Analysis Tools

See Q6LXS5 at UniProt or InterPro

Protein Sequence (79 amino acids)

>MMP_RS06545 ferredoxin family protein (Methanococcus maripaludis S2)
MECSTKKPYPVINALECKACERCIIACPKDVLKMSKDCNERGYNYVIYTGEGCTGCGNCY
YTCPEPLAIEVHIPLKKCE