Protein Info for MMP_RS06535 in Methanococcus maripaludis S2

Annotation: 2-oxoacid:acceptor oxidoreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF02775: TPP_enzyme_C" amino acids 73 to 223 (151 residues), 69.7 bits, see alignment E=2.4e-23 PF01558: POR" amino acids 308 to 470 (163 residues), 138.8 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 69% identical to VORA_METTM: Ketoisovalerate oxidoreductase subunit VorA (vorA) from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)

KEGG orthology group: K00187, 2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC: 1.2.7.7] (inferred from 100% identity to mmp:MMP1271)

Predicted SEED Role

"Ketoisovalerate oxidoreductase subunit VorA (EC 1.2.7.7)" in subsystem Ketoisovalerate oxidoreductase (EC 1.2.7.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.7

Use Curated BLAST to search for 1.2.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXS7 at UniProt or InterPro

Protein Sequence (479 amino acids)

>MMP_RS06535 2-oxoacid:acceptor oxidoreductase family protein (Methanococcus maripaludis S2)
MAEITEKVLKKPNAMPEIFERKGGSAPTATHYCAGCGHGIIHKLMAKSMDELEIQDRCVL
ISPVGCAVFAYYYFDCGNIQVAHGRAPAVGTGVSRAEDNAIVMSYQGDGDLASIGLNETL
QAANRGEKMAVFFVNNTVYGMTGGQMAPTTLIGEKTVTCQTGRDPRFAGYPIHMCELLSS
LKAPVFIERVSVSDIAHIRKAKRAIKKALEIQRDGKGYAFVEILSPCPTNLKQNAQAAEK
FINEEMEKEFPLQNFRDRSAEVETLNRGESDFSKECLDKIFEVDSKGSEDPSKDDSFEEK
LVKIAGFGGQGVLSMGLTLAEAACRAQKYVSWYPSYGPEQRGGTSNCSVIISGQEIGSPV
VYNPEVLIALNKPSLENFAKDVKVGGTIIYDENIGEFEVPNGVTAIKVPASKIATEMGVS
RAANTVMLGVLAEIGYTGLSESVFVGAIEQTFSKKPKLIPINVEILNAGISWAKENLAL