Protein Info for MMP_RS06380 in Methanococcus maripaludis S2

Annotation: O-phospho-L-seryl-tRNA:Cys-tRNA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR02539: O-phospho-L-seryl-tRNA:Cys-tRNA synthase" amino acids 12 to 379 (368 residues), 573.5 bits, see alignment E=9.4e-177 PF00155: Aminotran_1_2" amino acids 64 to 255 (192 residues), 20.5 bits, see alignment E=3.7e-08 PF00266: Aminotran_5" amino acids 83 to 239 (157 residues), 56.8 bits, see alignment E=2.9e-19 PF05889: SepSecS" amino acids 100 to 375 (276 residues), 109.6 bits, see alignment E=2.3e-35

Best Hits

Swiss-Prot: 100% identical to SPSS_METMP: O-phospho-L-seryl-tRNA:Cys-tRNA synthase (MMP1240) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06868, Sep-tRNA:Cys-tRNA synthetase [EC: 2.5.1.73] (inferred from 100% identity to mmp:MMP1240)

MetaCyc: 68% identical to Sep-tRNA:Cys-tRNA synthase monomer (Methanocaldococcus jannaschii)
RXN-10719 [EC: 2.5.1.73]

Predicted SEED Role

"O-phosphoseryl-tRNA:Cysteinyl-tRNA synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXV6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>MMP_RS06380 O-phospho-L-seryl-tRNA:Cys-tRNA synthase (Methanococcus maripaludis S2)
MDINTDKYKNITRNLEREMINLNPIQRGGILPTESKKIIYEYWDGYSVCDYCSGRLDQIE
TPPINEFLEDMSKFLGMDITRPTHGARESKYAVMNSICKEGDYVVLDGNAHYTSYVALER
AKLNYEKTDIEEYPTFRVIPESYAEKIDMLEDSKKNIGLILLTHVDGNYGNVADVEKVGK
IAKSKGYPFLLNCAYSAGRMPIDGKKLNVDFIAASGHKSMAASGPCGLLSINKKYENEVL
ETSKVNVLKELQMLGCTSRGIPILSLMASFEHLIERVKKWDLELEKTRKVVNELEPLGFK
QIGEKPRNHDIIRFETPILDEIAEKDKRRGFFFYEELKKRGIGGIRRGVTKEFKMSVYGL
TNTQVDYVINSMKSIINELR