Protein Info for MMP_RS06305 in Methanococcus maripaludis S2

Annotation: transporter substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00497: SBP_bac_3" amino acids 35 to 253 (219 residues), 113.3 bits, see alignment E=7.3e-37 PF09084: NMT1" amino acids 118 to 198 (81 residues), 20.7 bits, see alignment E=3.3e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1225)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXX1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>MMP_RS06305 transporter substrate-binding domain-containing protein (Methanococcus maripaludis S2)
MKRHSIGIIILLFLLSISIISGCISSQNTMKRGTLTVGVCAQYPPTIYEENGNLAGFDFD
LMNEIAKRMNLNTDFKIYNSKSELFDALEKNEVDCIGSRTVNYERRKFVDFTRVYYYDSV
RVAVPESSSVTLLKELKGKNLGVIEGSVSSELVESYLTNIGCKCLYYDTPENLTNAVENG
EVDAVIGHEMYLEHISTKCNVQKRYLDEKLSVSYWAIPINKNNPNLRNSINDILLEMEND
GTLDELKLKWYGKY