Protein Info for MMP_RS06275 in Methanococcus maripaludis S2

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 580 to 597 (18 residues), see Phobius details PF04851: ResIII" amino acids 19 to 209 (191 residues), 40.3 bits, see alignment E=6.5e-14 PF00270: DEAD" amino acids 30 to 100 (71 residues), 35.5 bits, see alignment E=1.7e-12 PF13307: Helicase_C_2" amino acids 464 to 622 (159 residues), 100 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: K01529, [EC: 3.6.1.-] (inferred from 100% identity to mmp:MMP1219)

Predicted SEED Role

"DinG family ATP-dependent helicase YoaA" in subsystem DNA repair, bacterial DinG and relatives

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXX6 at UniProt or InterPro

Protein Sequence (669 amino acids)

>MMP_RS06275 ATP-dependent DNA helicase (Methanococcus maripaludis S2)
MDFYEFKEYSKEKFPYHGMRPQQEVLMGKIYECVTKKKNLVVEAPTGVGKTLSYLIPALY
FAERGKRVMILTETIDQQERIVEDLNSLKHNLKVSFMMGKGNFFCKAKGEKANTLYCQLN
KGCIYRPNKKPVCVCGTKKEKIEFDGNTTFYCPLCLCDYQKAKIESFDANIIVMNNSIYY
YLKDEIDKKKQTDIVICDEAHKLEGSIRNAATIVINPKYALRRLRFMAYHYSNSRLRVHM
DRVTEEDDEIFWTIVEDYVVKNASGKDCKNSLVFDGFKITSFGLKEDVAILGTLLEGYNE
IVKIKEKIEDLSENEELDKKDLKFKIDNKALIPLELQFVADRRISDVPMVEFLENLGNLR
NITGNFVVYKNNGSILCEPVLVSTYLNRLYGDASVVHCSATLGDLKIHAIKTGMGRSETL
LLDSPFSKDRRNIIALSDGEDMKFNSIDFQSNNKKRNKANENLFKMVNAAKGNTLILFKS
FGDLKTAHEYFLDAGYRGNIYCYESGMDGKAAKKLKEDFQKYGGLLLATGRFAEGVDIPG
DALTCVIIDSLPFPVPTPLLKREQTLLEERLKSRKVKDAHWSAFLMTSFHIMARTVIQMI
GRLIRTETDYGVVVIQDKRFNDWVGSEMLKRKYLKDKFLPMSVDTATEYIPKFMKKMKED
NLKNSSFFK