Protein Info for MMP_RS06210 in Methanococcus maripaludis S2

Annotation: type I glutamate--ammonia ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00653: glutamine synthetase, type I
  • amino acids 5 to 444 (440 residues), 597.9 bits, E=6.4e-184
• PF03951: Gln-synt_N
  • amino acids 15 to 103 (89 residues), 99.9 bits, E=4.9e-33
• PF00120: Gln-synt_C
  • amino acids 111 to 443 (333 residues), 462.5 bits, E=8.9e-143

Best Hits

Swiss-Prot: 100% identical to GLN1A_METMP: Glutamine synthetase (glnA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to mmp:MMP1206)

MetaCyc: 55% identical to GlnA (Thermotoga maritima)

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• ammonia assimilation cycle I (1/2 steps found)
• ammonia assimilation cycle II (1/2 steps found)
• L-aspartate degradation II (aerobic) (1/3 steps found)
• L-aspartate degradation III (anaerobic) (1/3 steps found)
• superpathway of ammonia assimilation (plants) (1/3 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

See O59648 at UniProt or InterPro

Protein Sequence (446 amino acids)

>MMP_RS06210 type I glutamate--ammonia ligase (Methanococcus maripaludis S2)
MNAVEQAMEYIKTNNVKFIRFQFVDIHGEPKNIAYPVKAGAAGEEELYDVLEKGVYFDGS
SIEGFVSIESSDMMLKPDLKTLSVLPWRPTEKSVARVICDVYTTNGKPFEGDPRGCLKRV
LAKFDEELGGEFFVGPEPEFFILKEDACGSWVPADDAGYFDLEPLDGGCDIRRKIVFALE
NLGFHVEASHHEVAEGQHEVDFKFADAVKTADSVVTFKTTIKTLAAQDGLKATFMPKPFF
GINGSGMHCHQSIWLNGEPSFYDESAQYQLSETCMSYVAGILDHAKSIVAVTNPTVNSYK
RLVPGYEAPVNIAWANSNRSAIVRVPAPRGKGTRIEFRAPDPACNPYLAFTVMLAAGLDG
VKRKLSAIEPVEKNIFAMSEAQKKAEGIESVPANLKAALDELENNSVLKDALGKHIFENF
IEIKNAEWDSFRTAVTDWETKQYLKI