Protein Info for MMP_RS06180 in Methanococcus maripaludis S2

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR01048: diaminopimelate decarboxylase" amino acids 13 to 429 (417 residues), 517.5 bits, see alignment E=1e-159 PF02784: Orn_Arg_deC_N" amino acids 51 to 299 (249 residues), 193.3 bits, see alignment E=4.7e-61 PF00278: Orn_DAP_Arg_deC" amino acids 113 to 387 (275 residues), 78.4 bits, see alignment E=4.1e-26

Best Hits

Swiss-Prot: 72% identical to DCDA_METJA: Diaminopimelate decarboxylase (lysA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to mmp:MMP1200)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXZ3 at UniProt or InterPro

Protein Sequence (436 amino acids)

>MMP_RS06180 diaminopimelate decarboxylase (Methanococcus maripaludis S2)
MEFLGNEMITVDGGNLKIDGHDASKLASTYGTPLYVMSETQTVKNFTRYVESFKEYSEKT
GKEFIISFAYKANTNLAVTRLLSKLGCGADIVSAGELYIAKLSDVPSEKIVFNGNCKLKE
EIKMGIEAEIRAFNVDSISELVLINETAKEMGKIANVAFRVNPNVDAKTHPKISTGMKKN
KFGLDIESGIALETIKMAEKMENVKIVGIHCHIGSQLTYISPFVEEARKIMDFVVLLKNE
GIKIRDVNLGGGLGIPYDKNTKIPVQKDLSKAVLDVIYEYEGKIELPNLILEPGRSLVAT
AGVLLGTVEHVKETPVAKWVMIDAGMNDMMRPAIYESYHEITPCTIRAEKEVVSVAGGLC
ESSDVFGKDREISKMEVKDTVAILDVGAYGISMANNYNSRGKPAMILTNEKEVSLIRARE
TLADLISKDIVPNHLL