Protein Info for MMP_RS06125 in Methanococcus maripaludis S2

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 19 to 234 (216 residues), 241.3 bits, E=3.7e-76
• PF06026: Rib_5-P_isom_A
  • amino acids 64 to 232 (169 residues), 199.2 bits, E=2.1e-63

Best Hits

Swiss-Prot: 100% identical to RPIA_METMP: Ribose-5-phosphate isomerase A (rpiA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to mmp:MMP1189)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• pentose phosphate pathway (5/8 steps found)
• Bifidobacterium shunt (10/15 steps found)
• oxygenic photosynthesis (10/17 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• ethene biosynthesis V (engineered) (12/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

See Q6LY04 at UniProt or InterPro

Protein Sequence (239 amino acids)

>MMP_RS06125 ribose-5-phosphate isomerase RpiA (Methanococcus maripaludis S2)
MARTKKANDEVATDSDSLKLKVAKQAAKLVKDEMVVGLGSGSTANLFIQELGKRVVEEEL
YIYGVPTSFDSRMMASNSGIPLISLDQCGEIDIAIDGADEVCKKTLSLIKGGGGCHTMEK
IVDYHAKEFVVLADEGKLVESLGDKTAVPLEVIPFAYSTVLNKLLDMNTAPAIRSGSGKM
GPVITDNGNMIIDVFINIEDAEETETMLNNIPGVLENGIFSKCDKVLVGTSKKVEILKK