Protein Info for MMP_RS06110 in Methanococcus maripaludis S2

Annotation: ATP-dependent protease LonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 115 to 133 (19 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details TIGR00764: putative ATP-dependent protease" amino acids 3 to 690 (688 residues), 691.7 bits, see alignment E=4.8e-212 PF01078: Mg_chelatase" amino acids 21 to 67 (47 residues), 21.4 bits, see alignment 5e-08 amino acids 229 to 320 (92 residues), 21 bits, see alignment E=6.7e-08 PF13654: AAA_32" amino acids 192 to 299 (108 residues), 22.6 bits, see alignment E=3.3e-08 PF00158: Sigma54_activat" amino acids 231 to 273 (43 residues), 28.9 bits, see alignment 3e-10 PF05362: Lon_C" amino acids 488 to 687 (200 residues), 74.6 bits, see alignment E=3e-24 PF13541: ChlI" amino acids 573 to 661 (89 residues), 30.5 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K04076, Lon-like ATP-dependent protease [EC: 3.4.21.-] (inferred from 100% identity to mmp:MMP1186)

Predicted SEED Role

"ATP-dependent protease LonB Type II"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY07 at UniProt or InterPro

Protein Sequence (692 amino acids)

>MMP_RS06110 ATP-dependent protease LonB (Methanococcus maripaludis S2)
MFSVQFKTTDELPKPSPNLINQVIGQDEAVKIVLSAVKNKRHALLLGDPGVGKSMMVKAF
GQLLEHSSDFKPYSLIARPNIKNSEKPIVDLIEGRMIEETAQIESPKLMRQPPSIFTLLL
GIIVSSLVLSYILNGLSDPSSKFAVIAAISVIGSLLVFLILFLNIFGATKASMPNSVSPA
DVKPLVLYECKKRPLVRASAYNTTKLLGDIKHCPLGGKPPIGTPPHKRVIIGAIHEAHKG
ILYVDEIKTMPVDVQDYILTALQDKQLAISGRNPNSSGASVETNPIPCDLTLIMSGNMDD
ASNLRAPLLDRIDYKVVLKNKMDNNQENRDKLLQFIVQELENNNLRPMSYEACCEIVRMA
QLLSGSKNKLTLRLRQLSNIIKMANDIATGKELSESIEEMSEKEVKPEVTVKAVKPAEKK
NTRKIRAVVGKLKPKKSEEVIKEVKPVSKAPVLEKDDRVIELDHINEIISTGIYSMSKQV
AIDYLKNFKRYKNIVSNDKPKIGVIHGLAVLGADGLGDVTKIITKIVKSKHPRTNLLNIS
GDLAKHSITLASALSKKLVSDGTLSIAKAKGEVAKEDLDLAEHEIYIQFSQSYSKIDGDS
ATAAACLSIISSLLNIPLKQDFCITGSLDLNGEILAIGGVNEKINAAKEYGFKRVIIPQS
NFEDVIDPEGIEVIPVTRLEEIIPLAFELNNL