Protein Info for MMP_RS06100 in Methanococcus maripaludis S2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF00583: Acetyltransf_1" amino acids 14 to 147 (134 residues), 47.5 bits, see alignment E=4.3e-16 PF13508: Acetyltransf_7" amino acids 43 to 149 (107 residues), 40 bits, see alignment E=8.3e-14 PF13673: Acetyltransf_10" amino acids 88 to 151 (64 residues), 27.3 bits, see alignment E=6.5e-10 PF08445: FR47" amino acids 91 to 150 (60 residues), 37 bits, see alignment E=5.7e-13

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to mmp:MMP1184)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY09 at UniProt or InterPro

Protein Sequence (172 amino acids)

>MMP_RS06100 GNAT family N-acetyltransferase (Methanococcus maripaludis S2)
MVIRNARKTDIDEIMNIEYDSFIDGISENRNVFLDRIATFQNGFLVLEVDSEILGYISSE
IWEYSENIDEKRFDLNHDIKKVHKCNGSELYISSIGILKKHRKKGYGNLLFKELIEKISK
NYKISSMILTVSVNWKPAIKLYEKNGFKEICRIKEFFEDEDSSDGIVMRKYI