Protein Info for MMP_RS06070 in Methanococcus maripaludis S2

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 57 to 304 (248 residues), 78.6 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 56% identical to Y085_METJA: Uncharacterized lipoprotein MJ0085 (MJ0085) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to mmp:MMP1178)

Predicted SEED Role

"Iron transport Periplasmic binding protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY15 at UniProt or InterPro

Protein Sequence (373 amino acids)

>MMP_RS06070 iron ABC transporter substrate-binding protein (Methanococcus maripaludis S2)
LNKKIISIIVALMMSLVVALSGCVESSDSGTSEDIKTVEIVDMVGRTVEIPADVQKIVCS
GPGCLRLISYLNATDKLVGIEDFENTNLIGRPYRLAHPEFSELSVIGNGGPQDINVGPDP
EKVLNVMPEVIFITYIDSDNADELQKKTGIPVVVLSYGALGNFKNDAIFNSLTLCGEILG
KEERAEEVISFISNIQDDLDKRTSEIPDEEKPSIYVGAIGNKGIHGIDSTEGSYPPFESL
NTENIAKTASNEHIFISKEQLIEWNPEFIFIDEGGISIVYEDYEKNPDYYNSLDAFKNGN
VYGILPFNYYTTNIDTAMADSYYIGTILYPEAFSDIDPKAKADEIYEFLVGKGVYSKMNE
MFEGFENLDFSNQ