Protein Info for MMP_RS06055 in Methanococcus maripaludis S2

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 4 to 135 (132 residues), 105.4 bits, E=3e-34
• PF08534: Redoxin
  • amino acids 5 to 142 (138 residues), 48.6 bits, E=1.2e-16
• PF10417: 1-cysPrx_C
  • amino acids 156 to 195 (40 residues), 27.9 bits, 2.7e-10

Best Hits

Swiss-Prot: 100% identical to TDXH_METMP: Peroxiredoxin (MMP1174) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to mmp:MMP1174)

Predicted SEED Role

"Probable peroxiredoxin (EC 1.11.1.15)" in subsystem Oxidative stress or Rubrerythrin (EC 1.11.1.15)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.15

Sequence Analysis Tools

See Q6LY19 at UniProt or InterPro

Protein Sequence (217 amino acids)

>MMP_RS06055 peroxiredoxin (Methanococcus maripaludis S2)
LVVIGEKFPEVEVTTTHGKLKLPEHYIESGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQF
RELNTELIGLSIDQVFSHIKWVEWIKEKLDVDIEFPIIADDRGELAVKLGMISPYKGNNT
VRAVFVVDATGTIRAIIYYPQEVGRNMDEIVRLVKALQTADKGYATPANWPNNDFLNEKV
IVPPANNMDARKKRLEACKSGELEGYDWWFCYTDLKE