Protein Info for MMP_RS06050 in Methanococcus maripaludis S2

Annotation: ZIP family metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details PF02535: Zip" amino acids 13 to 104 (92 residues), 37.6 bits, see alignment E=7.9e-14 amino acids 122 to 264 (143 residues), 48.7 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 100% identity to mmp:MMP1173)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY20 at UniProt or InterPro

Protein Sequence (269 amino acids)

>MMP_RS06050 ZIP family metal transporter (Methanococcus maripaludis S2)
MAPLTSYNPVFLALLATIFTWLVTALGASLVYLTKTVNRKLLDISLGFAAGIMIAASFWS
LLAPAIELSSSMDNLSWFPASFGFLIGAFFLAGIDKIVPHLHMGQPLKEAEGPKTTWHKN
RLLLMAVTIHNIPEGLAVGIAFGALALNMSVDSLMAAIVLALGIGIQNFPEGIAVSFPLR
GEGLSKNKSFFYGQLSAIVEPIAGVLGAFLVTIFTPLLPYALSFAAGAMMFVVIEDIIPE
CQREGNIDSATIAAIFGFIVMMILDVALG