Protein Info for MMP_RS06045 in Methanococcus maripaludis S2

Annotation: DNA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF00210: Ferritin" amino acids 21 to 162 (142 residues), 78.7 bits, see alignment E=2.2e-26

Best Hits

Swiss-Prot: 64% identical to DPS_PYRFU: DNA protection during starvation protein (dps) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1172)

Predicted SEED Role

"Ferritin-like protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY21 at UniProt or InterPro

Protein Sequence (183 amino acids)

>MMP_RS06045 DNA polymerase (Methanococcus maripaludis S2)
MAKVSREMVENSGINVDELVELLVKNAAAELTTFYYYTILRVNLIGLEGEGLKEIAETAR
IEDRNHFEALVPRIYELGGSLPKDMKDFHDISGCPPAYLPDDVTDINKLMKVLLQAEQCA
VKQYTKICNITAGKDHRTYDLALAILNEEIQHESWFSEFLGDGPSGHFLRQGKTSPFVSK
FLE