Protein Info for MMP_RS06015 in Methanococcus maripaludis S2

Annotation: flavodoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF02525: Flavodoxin_2" amino acids 1 to 124 (124 residues), 37.4 bits, see alignment E=2.3e-13 PF03358: FMN_red" amino acids 1 to 155 (155 residues), 126.3 bits, see alignment E=7.8e-41

Best Hits

Swiss-Prot: 68% identical to ISF1_METJA: Iron-sulfur flavoprotein MJ0731 (MJ0731) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1166)

Predicted SEED Role

"Iron-sulfur flavoprotein MJ0731"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY27 at UniProt or InterPro

Protein Sequence (197 amino acids)

>MMP_RS06015 flavodoxin family protein (Methanococcus maripaludis S2)
MKILGISGSPRKEGTHFAVNYALDYLKEKGFETKYISVFQKKIEFCIHCDYCLRTKEGCV
HKDSMQEIYNGLKWADAVILGSPCYNGTVSGQLKTIMDRCRAIFAEDIDVLRNKYGMALS
VGGDRNGGQEVVLKTIHDFYILNGVIPVSGGSFGSNLGATFWSQDNGKKGVEEDTEGIRT
LKRTLKKFYNCLNEEGE